Biological dynamics in performance space
(bio-performance)
Yiannis Melanitis,
38 Kynigon str,
N.Kifisia, PC 14564, Athens, Greece
Performance artist, MA Digital Arts,
Phd Fellow at the School of Architecture, Athens, Greece
Collaborator at the Sculpture Deptm., Athens School of
Fine Arts, Athens, Greece
e-mail:
melanitis@hotmail.com
http://www.geocities.com/melanitis2004/Garden1.html
In this paper I attempt to investigate
biological dynamics in the field of performance space. I use my term
'bio-performance' [1] in an effort to describe performance procedures deriving
from genetics. In a large-scale performance work entitled "The
Garden" ( partially performed in Athens, 2005, videofile:
http://www.geocities.com/melanitis2004/Gardenvideo.html), the music
interpretation of the genetic sequence (antenappedia gene) of a mutant fruitfly
consists the environmental sound (background layer).
A dictionary definition
[http://www.wikipedia.org] of the term 'genetic algorithms' is that they are
"typically implemented as a computer simulation in which a population of
abstract representations (called chromosomes) of candidate solutions (called
individuals) to an optimization problem evolves toward better solutions.
Traditionally, solutions are represented in binary as strings of 0s and 1s, but
different encodings are also possible. The evolution starts from a population
of completely random individuals and happens in generations. In each
generation, the fitness of the whole population is evaluated, multiple individuals
are stochastically selected from the current population (based on their
fitness), modified (mutated or recombined) to form a new population, which
becomes current in the next iteration of the algorithm."
Though, in what way such
representations may be used in the artistic process? Perhaps an innovative way
to use genetic algorithms is when they operate within a work without -at least
in the first case- been so evidently noticed even if they formulate the
structure of the work. [Heraclitus r. 54: An unapparent harmony is stronger
than an apparent one.] [2]
Concerning "The
Garden" and "The Diffusion of The Elements" performances, space
is not considered to be 'a place of action'. Instead of this, we might consider
it as a field with inputs and outputs where interactivity interlinks the
assortment of the elements. As explained later, technology concealed inside the
elements aims to provide an interconnection between various space qualities.
The music evolution procedure
paradigm used (explained below), is that of 2 genetic pools interchanging data
(inheritance (the notes stay for some time in pool 1) mutation techniques
inspired by evolutionary biology such as inheritance, mutation, natural
selection, and recombination (or crossover).
Every performance involves an
agent, acting within a spatial configuration serving as its container. Their
interaction triggers the "event". This threefold set of
"agent-space-event" is dynamic and perpetually interactive: it
develops in time by means of formal modifications. The event, i.e. the
interaction between the agent (figure) and its spatial configuration
(environment), occurs as a kind of mutation- hence the performance proceeds in
an evolutionary mode: a series of figural and spatial changes which is represented
by sequences of their transformations.
"Might not the
dancers be real puppets, moved by strings, or better still, self propelled by
means of a precise mechanism, almost free of human intervention, at most
directed by remote control ?" Oscar Schlemmer
The distinction between
geometrical and functional space in performance theory was emphasised by Oscar
Schlemmer in his works and lectures at the Bauhaus.[3] Geometrical space refers
to linear constructions and orbital dancing methods, whereas functional space
invokes the response of the agent. Schlemmer's "Dance in space" and
"Figure in space with Plane Geometry and Spatial Delineations"
performances, intended to transform the body into a "mechanised
object" operating into a geometrically divided space, pre-existing the
performance. Moreover, the proposition for the remotely controlled dancer of
the mechanical ballet might serve as an endeavour to reform the body into a
receptor of information that comes from the container space. Hence, movement is
precisely determined by the information from the environment.

Fig.1. Oscar
Schlemmer, "Slat Dance".

Fig.2. "Figure in
Space with Plane Geometry and Spatial Delineations."

Fig. 3.The dance from
the film "Vita Futurista",1916, by Marinetti, Balla,
Corra.
The Futurists proposed the
system of human-machine and their interactions as the model of new aesthetics.
They manifested an expansion in time and space for the body that emerged from
the power and the glorification of the machines.
Umberto Boccioni, in his
manifesto named "Absolute Motion + Relative Motion= Dynamism 1914",
writes: "Absolute motion is a dynamic law inherent in an object. The
plastic construction of the object must here concern itself with the motion which
an object has within itself, whether it be at rest or in movement? Relative
motion is a dynamic law which depends on the object's movement. It is quite
incidental whether we are talking about moving objects or the relationship
between moving objects and non-moving objects. In fact, there is no such thing
as a non-moving object in our modern perception of life."
Marianne W. Martin in
"Machine Aesthetics and the Dehumanization of Art" : "Marinetti
hoped that the artist would overcome his physical limits and 'merge' into the
infinite of space and time' and initiate 'the mechanical kingdom' supplanting
'the animal kingdom'. Appropriately enough, Marinetti also envisaged the
accompanying evolution of a new being, an immortal superman who will be
'mechanized' with replaceable parts.' " [4]
2.
PERFORMANCE PROPOSAL
Bio-performance, a theory
based on the conception of the "analogical body" (as
opposed to digital), attempts
to re-establish the corporeal status of experience de-depending the body from
the domination of simulations or virtual allusions.
Performance has to be defined
as the dialectical mechanism between body and context. The concept of
performance is based on interaction, in the sense that the body of the
performer is dynamically -and non-reversibly- transformed by the environment,
as well as the environment is transformed by the movements of the performer.
Interaction occurs and evolves because the body does not have an overview of
the context. Hence the body needs to move. Movement in turn, causes transformation
of the spatial configuration as well as of the body itself, a perpetual
process. The question then becomes what are the operations for these
alterations? Do they fall into patterns and/or other regularities? Here is the
point that we have to reverse the question. We do not have to leave the body
move voluntarily, but the genetic algorithms might provide a grid for their
trajectories in space, so these patterns are varieties inside our evolutionary
pathway.

Fig.4.
Drawing from the Bauhaus.
From information systems to
bio-information processes- the invasion of information on the body.
Within the borders of
bio-capitalism, biotech is formalising nature into molds, mechanising organic
systems, applying informatics in the bio-organic level. Placed within this
framework, information is transformed to bio-information which is mechanically
imposed on the body, potentially altering its developmental perspective. As P.
Rabinow claims in his essay titled "Artificiality and Enlightenment: From
Sociobiology to Biosociality" [5]: " the object to be known- the
human genome- will be known in such a way that it can be changed. This
dimension is thoroughly modern; one could even say that it instantiates the
definition of modern rationality". Genetic information, due to its
complexity, provides a source of transforming the body into a complex system
which brings about unpredictable outcomes.
If a performance theory aimed
to present the body as a bio-analogic system, all representations and
interactions should be replaced by competitive systems and evolutionary
processes.
A substantial discrimination
between the geometrical space of Oscar Schlemmer and bio-performance may be
observed in their relationship with the body :
Schlemmer/Bauhaus
|
Virtual Reality
performances |
Bio-performance |
|
space= soft {As
Schlemmer puts it: "a space filled
with pliable substance in which the figures
of the sequence of the dancer's
movements were to harden as a negative
form." The body of the
dancers obtain an 'object' quality,
moving in a rather predictable
way. [3] |
The body "disappears" and isremotely controlled.
Its feedback is
determined by external information
or through
interactions. |
body= soft,
malleable. The body should have a
"liquid space" movement within
space. |
In the bio-performance, the
information is perceived from the outside, processed by the body and exported
to the initial source (the environment) [6] . Environment though, is a complex
concept, that may include self-derived parts or functions of an organism which
can potentially be activated in relation to it. (e.x some genes within an
organism may be part of a gene's environment )[7]. In this sense, performer and
environment become comparable entities. The concept of the performer owning an
altering body whose form is perpetually dissolved and recomposed, leads us to
consider performance as an organism.[8] The technique of this transformation is
realised by emphasizing its bio-analogical responses.
Schematic of the performance space

Fig. 5, Diagram for the spatial arragment of the Garden performance. Below, Fig. 6., the ancient Greek Theater diagram with Orchestra, Theatron["theater," lit. "place for viewing," from theasthai "to behold" (cf. thea "a view," theates "spectator") + -tron, suffix denoting place. ,)], Skene and Parodos.


Fig.
7. Schlemmer's stage diagram for Gesture Dance,Bauhaus, 1926
Chorus
and the sound synthesis of the performance
'Music is
sound, that is, movement. The goal is to bring sound itself to life.'
Xenakis, in Balint Andras Varga, Gesprache mit Iannis
Xenakis, trans. Peter Hoffmann. p.62
|
ancient drama |
Chorus of the ancient drama |
narration/singings/dance |
|
bio-performance |
Chorus of 3 women |
singing: aischrologia (=abuse words) |
Transformations through
codifications (encoding letters inside the notes)
Encryption of the word
"BACH" inside the fugue from J.Sebastian Bach at the last work Art of
the Fugue/Die Kunst Der Fuge.
The third theme of the
unfinished four-part fugue starts with the sequence from Si-La-Do-Si minor
("BACH")
Fuga_a_3_Soggetti_Contrapunctus
14.aif ________________
Fuga_a_3_Soggetti_Contrapunctus
14.aif(Fragment 6:00-6:03)____
Less visible in Contrapunctus
4____
Contrapunctus 4(bar135-136)
played by the viola
Also in Contrapunctus 11, at
the satrt of the anti-theme with eights (after the initial fugue theme) and
finally forms the 3rd theme of the fugue
Genetic
algorithms (real-time DNA transcription) in the Garden performance
The
sound synthesis consists of three sound layers:
1. the background 'environmental' synthesis, based on the DNA sequences of
the mutant fruitflies. sound file
(through MAX/MSP) [file: backgr3.aif]
2. the ‘male’ foreground synthesis based on the
thermal scanning of space. Thermal outputs are transformed to skirl real-time
sounds (through MAX/MSP) [file:Thyrsus20050528takeB.aif]
3. the female chorus, consisting of seven women which periodically sing a
synthesis based on the names of the 4 DNA bases (adenine (A), thymine (T), cytosine (C) and guanine (G)) resembling female abuse, as
women practised in ancient Thesmophoria. [file: femaleChorus1.aif]
The series by
which the four proteins appear in time, is the DNA chain. The DNA chain is
transcribed to syllables (parts of the names) of the four proteins. Each singer
sings one phoneme at a time.
One of the most striking mutations in Drosophila is the conversion of antennae into legs by the gain-of-function dominant mutation, Antennapedia.

Fig. 8. HOMEOTIC
TRANSFORMATIONS involving the Antennapedia Complex (ANTC)
Adult fly heads: wild
type, antennapedia (antennae transformed to 2nd thoracic legs) and a double
mutant proboscipedia/ antennapedia (antennae to 2nd thoracic and proboscis to
1st thoracic legs).
Music Fly
The DNA of a fly (894 bases)
is used as a base for the production of music. A specific algorithm was
designed for the interpretation of the DNA code. This music piece is then
arranged to aesthetic preference and transformed to a new DNA sequence which
becomes a representation a "music" fly. This new organism could even
be produced /in the lab as new organism /or as a computer model.
The 894 bases of the
antenappedia gene:
1 atgacgatga gtacaaacaa
ctgcgagagc atgacctcgt acttcaccaa ctcgtacatg
61 ggggcggaca tgcatcatgg
gcactacccg ggcaacgggg tcaccgacct ggacgcccag
121 cagatgcacc actacagcca
gaacgcgaat caccagggca acatgcccta cccgcgcttt
181 ccaccctacg accgcatgcc
ctactacaac ggccagggga tggaccagca gcagcagcac
241 caggtctact cccgcccgga
cagcccctcc agccaggtgg gcggggtcat gccccaggcg
301 cagaccaacg gtcagttggg
tgttccccag cagcaacagc agcagcagca acagccctcg
361 cagaaccagc agcaacagca
ggcgcagcag gccccacagc aactgcagca gcagctgccg
421 caggtgacgc aacaggtgac
acatccgcag cagcaacaac agcagcccgt cgtctacgcc
481 agctgcaagt tgcaagcggc
cgttggtgga ctgggtatgg ttcccgaggg cggatcgcct
541 ccgctggtgg atcaaatgtc
cggtcaccac atgaacgccc agatgacgct gccccatcac
601 atgggacatc cgcaggcgca
gttgggctat acggacgttg gagttcccga cgtgacagag
661 gtccatcaga accatcacaa
catgggcatg taccagcagc agtcgggagt tccgccggtg
721 ggtgccccac ctcagggcat
gatgcaccag ggccagggtc ctccacagat gcaccaggga
781 catcctggcc aacacacgcc
tccttcccaa aacccgaact cgcagtcctc ggggatgccg
841 tctccactgt atccctggat
gcgaagtcag tttggtaagt gtcaaggaaa gtga
There are only four different bases and thus only four
different nucleotides. The four bases are adenine (A), thymine (T), cytosine
(C) and guanine (G). Genes are sections of DNA, in which the neucleotides are
viewed in groups of three called "triplets" or "codons".
Each codon "codes" for a particular amino acid (amino acids are glued
together to make proteins.)
Antenappedia protein sequence:
MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMP
YYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQL
QQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHP
QAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNS
QSSGMPSPLYPWMRSQFGKCQGK
Foreground
synthesis
Music is derived from the
thermal scanning of the performance space (a
FLIR thermal camera was used for this reason, connected to a computer running
MAX-MSP) while the protein sequence rows
through real time music transcription:

Fig. 9.Thyrsus-Cyclops diagram (assembled in collaboration with composer V. Kokkas): DNA is used to shape noise waves thus creating the acoustic environment.The current DNA base creates a ramp which drives the parameters of FM1 and FM2.
Nine triangle wave generators which are controlled by the chromatic codes of the thermal image captured by the camera. The main performer was appearing in my first sketches as bird-like mutant,[fig. 10] so the parameters of this system are adjusted to yield timbral (in greek=ixoxromatiki) texture which is a synthetic model of the birds' voice. [see natural birds' voice in diagram, fig. 11]

Fig.10. Drawing by
Yiannis Melanitis, first thoughts on the male performers’ image, ballpoint pen on paper, 2004


Fig.11.
sound
wave diagram of the Blue Jay
_the music of the thyrsus is
based on the song of the bird Blue Jay [Thyrsus20050528takeB.aif]
_the sound wave diagram of the
Blue Jay is also triangle shaped
_sound sample of Blue Jay: [blueJaySound.mp3]
<http://www.geocities.com/melanitis2004/Garden5.html>
‘The Garden’
is an interactive environment for 4 performers and a three-member female chorus

Fig.
11.’The Garden’, Image stills and video:
<http://www.geocities.com/melanitis2004/Gardenvideo.html>
In the
ensuing evolutionary steps of the work ‘The Garden’, a work partially
performed, being under a transformative process itself, genetic algorithms will
define its basic parameters (from agents trajectories till bodily prosthetic
forms.) Genetic algorithms are not merely guidelines for formalistic
interpretations; more essentially, they should function as a ‘source of
metaphors to remodel life, aiming, in partial, to reveal
the area that comprises the ‘parental scheme’, the initial philosophical idea
concealed under the external schemes, before the metaphors, still before the
first, the inceptive
transfer…
As Derrida says,[9] in all human
words, a .scheme had been
parently stamped, a materialized scheme and when they were all new, they represent
a certain perceptible image….inevitable materialism of the vocabulary… Whist in
‘The Garden’ the place of vocabulary coincides with the genetic base sequence,
our concern are not the coding transformations ; more extensively our aiming is
in the approximation of the initial, non-transferable concept…
For the
definition of the genetic algoritm through use of simulation computer program
for the fruitfly tests Yiannis Melanitis is collaborating with Bouzaklas
Ioannis, Geneticist, BSC in enetics MSC Molecular Medicine, Phd Medical School
of Athens, ioannis@enternet.gr
References.
1.
Highlights magazine , November 2004, issue 13 on "Technology",
interview with Christina Polychroniadis,entitled "Bio-performance"
2.
Socratis Gikas-Iason Evangelou, Presocratic Philosophers, Savalas publications,
Athens 1995.
3.
Oscar Schlemmer's notes, RoseLee Goldberg, Performance Art, Thames and
Hudson,
1988.
4.
Futurist Art and Theory, 1909-1915, by Marianne W.Martin, Oxford Press, 1968,
page 130.
5.
Paul Rabinow , in his article "Artificiality and Enlightenment: From
Sociology to Biosociality", refers to Gilles Deleuze's book "On the
Death of Man and Superhuman", which presents "Man as a distinctive
being, who is both the subject and the object of its understanding, but an
understanding that is never complete because of its very structure."
6.
Mae-Wan Ho, "The New Age of the Organism", A&D, volume 70, No 3,
June 00. page 48. "The whole is thus a domain of coherent activities,
consulting an autonomous, free entity, not because it is separate and isolated
from its environment, but precisely by virtue of its unique entanglement of
other organic space-times in its environment."
7.
Douglas J. Futuyma, Evolutionary Biology, third edition, Sinauer Associates,
Massachusetts, 1998, Glossary, see: "environment".
8.
Mae-Wan Ho, "The New Age of the Organism", A&D, volume 70, No 3,
June 00. page 48, " ...the parts behave as though they are independent of
one another. This is the radical nature of the organic whole(as opposed to the
mechanical whole), where global cohesion and local freedom are both maximised,
and each part is as much in control as it is sensitive and responsive."
9.
J. Derrida, “White Mythology”, Hestia editions, trans. By G. Faraklas.
Bibliography
1.
Stuart A. Kauffman, The origins of Order, (N.York : Oxford University Press,
1993),
2
. Facing the Future, Ars Electronica, published by Timothy Druckrey,(Cambridge
: The MIT Press, 1999)
3.
Socratis Gikas-Iason Evangelou, Presocratic Philosophers, Savalas publications,
Athens 1995.
4.
John Wood, The virtual Embodied, (London : Routledge books,1998)
5.
Ars Electronica Center, Lifescience, (Austria : SpringerWienNewYork, 1999)
6.
Mark Taylor , "HIDING", Chicago Press, 1997
7.
Incorporations, edited by Jonathan Crary and Sanford Kwiner, Zone 6, Zone
Books, , N.York, (1992)
8.
Fragments for a History of the Human Body, part 1, edited by Michael Feher,
ZONE 1990, N.York.
9.
Gary William Flake, The Computational Beauty of Nature, (Massachussetts: A
Bradford Book, the MIT Press, 1998)
10.
Bryan Kolb and Ian Q.Whishaw, Fundamentals of Human Neuropsychology, University
of Lethbridge, ( W.H. Freeman and Company, N.York, 1995 )
11.
T.W.Sadler, "Langman?s Medical Embryology, sixth edition, Williams &
Wilkins, Maryland, USA,1990
12.
George Gessert, " A History of Art Involving DNA", Ars Electronica,
Lifescience, Springel Wien New York, Austria 1999.
13.
Bob Johnstone, "Japan's Friendly Robots", MIT'S Technology Review,
May-June 1999
,
page 64, (1999)
14.
Genetics, Vol. 96, Issue 18, 10278-10283, August 31, 1999.
15.
Hans Moravec, "Mind Children: The Future of Robot and Human Intelligence.
Harvard University Press, Cambridge, Massachusetts, 1988.
16.
Friedrich Nietzsche. Thus Spoke Zarathustra. Trans. Walter Kaufmann. New York:
Penguin Books, 1981.
17.
Friedrich Nietzsche. Ecce homo. (Walter Kaufmann, Trans.). New York: Vintage
Books, 1967.
18.
Friedrich Nietzsche. The Will to Power. Trans. and Ed. Walter Kaufmann and R.J.
Hollingdale. NY: Vintage, 1967.
19.
Vilem Flusser, "Curie's Children," Art Forum Vol. 26, No. 7 (1988)
and Vol. 27, No. 2 (1988).
20.
G. Gessert, "A Brief History of Art Involving DNA," Art Papers
(Sept./Oct. 1996).
21.
G. Gessert, "Notes on Genetic Art," Leonardo Vol 26, No. 3 (1993).
22.
Theory of the Artificial, Virtual replications and the Revenge of Reality,
Massimo Negrotti, Intellect Books, England,1999
23.
Lee Silver, Remaking Eden, Princeton University, 1997.
24.
Steven Levy, Artificial Life, Vintage Books, N.York, [see chapter "The
Strong Claim", pages 311-348].
26.
A&D, volumes 68/11-12 Nov-dec 1998,70 No3 /June 00.
27.
Futurist Manifestos, edited by Umbro Apollonio.
28. France,
Anatole, The Garden of Epicurus, The Bodley Head Ltd 1923 , translated by
Alfred Allinson .
Links:
http://www.humancloning.org./
http://www.talkorigins.org/faqs/origin.html
http://cwis.usc.edu/dept/biomed/bme490.981/artificial_skin.htm
http://www.aec.at/lifescience/indexv4.html
http://www.newscientist.com/ns/981003/superhumans.html
http://www.ess.ucla.edu/huge/Biochips.html
http://www.biota.org/org/vision.html
http://prophecyclub.com/jan99/16.html
http://www.nih.gov/nigms/news/features/artificial_skin.html
http://cwis.usc.edu/dept/biomed/bme490.981/artificial_skin.htm
http://www.vegan-straight-edge.org.uk/taxonomy.htm
http://www.robotbooks.com/artificial-muscles.htm
http://www.ai.mit.edu/
http://faculty.washington.edu/wcalvin/bk8/bk8ch8.htm]
http://www.hedweb.com/nickb/superintelligence.htm
http://www.cs.usu.edu/~degaris/papers/journal.html